PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099533001
Common NameGSBRNA2T00099533001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 1354aa    MW: 153864 Da    PI: 8.0471
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099533001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.57.8e-3211901245258
            CBFB_NFYA    2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58  
                           ep++VNaKQy++I++RR++Rakle+++kl +ksrkpylheSRh hAl+RpRgsgGrF
  GSBRNA2T00099533001 1190 EPVFVNAKQYHAIMRRREQRAKLEAQNKL-IKSRKPYLHESRHVHALKRPRGSGGRF 1245
                           8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF522001.31E-413152IPR000157Toll/interleukin-1 receptor homology (TIR) domain
Gene3DG3DSA:3.40.50.101405.6E-249145IPR000157Toll/interleukin-1 receptor homology (TIR) domain
PROSITE profilePS5010428.5419149IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SMARTSM002555.5E-4310149IPR000157Toll/interleukin-1 receptor homology (TIR) domain
PfamPF015829.4E-4210175IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF525402.38E-51175438IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009317.2E-25203448IPR002182NB-ARC
Gene3DG3DSA:3.40.50.3001.7E-13205360IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF467851.55E-6416517IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:3.80.10.108.9E-34570673IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520586.8E-36578673IPR032675Leucine-rich repeat domain, L domain-like
PfamPF077252.7E-5603621IPR011713Leucine-rich repeat 3
SuperFamilySSF520586.8E-36746973IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.108.9E-34746967IPR032675Leucine-rich repeat domain, L domain-like
PfamPF138554.9E-8774832IPR001611Leucine-rich repeat
PROSITE profilePS514504.863775796IPR001611Leucine-rich repeat
PROSITE profilePS514507.088798819IPR001611Leucine-rich repeat
PROSITE profilePS514506.488822844IPR001611Leucine-rich repeat
PROSITE profilePS514504.971914936IPR001611Leucine-rich repeat
PROSITE profilePS514505.024946967IPR001611Leucine-rich repeat
SMARTSM005216.5E-3811871248IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.87211881248IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-2611901245IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-2211911213IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686011931213IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-2212221245IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 1354 aa     Download sequence    Send to blast
MASSSTRVRN YDVFLSFRGE DTRRTIVSYL YEALCREGII TFRDDRRLEA GDNISDQLIE  60
AIKTSWFAVV VISKNYATSK WCLEELRLIM ELHSANHIQV VPIFYGVEPT DVRNQTGSFA  120
AAFQNFEDLD TVPERVSQWR RALNQVSHLS GFHSTTWLDE AAMVAKTVQS VSSGLLTMRP  180
TIGVDLVGME AHMVKMHFLL NMGSKNEVLM IGIWGMGGVG KTTIAKCVYE RFSSQFPAHY  240
FIEDIKKIYK DKSPSYLQES FLYKITGQHI DFQRVVAGSQ VIKARLQHQK VLVVLDGVDK  300
AEQMHALAQD TSWFGRGSRI IITTQDRGLL TSCGVNHIHE VNCLEDKDAL QVFKKSVFGG  360
RRPPSDKFEK LFIRASRLAH GLPSALVAYA SHLSENTTIE RWEDELRLLE TSPHKNVEEI  420
LRNSYDGLDN KDKIAFLHVA CLLNGYPFNH VTSLIDDGCP RMNHLSKKSL ISISTDGCIN  480
MHFLVVQTGK EIVRQECKNR PFRQRFLWDA DDIYNVLDNK IGTDETEGLI LEMCKMCDTL  540
TMSDTVFEVM HSIKFLKFFL HLSDIKPNLQ LKSDGFYFPP NLRLLHWDAY PLKTLPSKFR  600
LHHLVEVDLR YSKLESLWDD TSILRNLHRL DVTGSKNLIQ IFPESLKGLL KLKKLNASHC  660
DSLKSILSNV ESITSEYTWQ VLLSFPYEKS SMVYLKDLSI DGQIHVKLLG LNGFADHISF  720
RSKQPIPDEL LMMEESTSHQ LMSDSKGLHS LNIMNFRYRE SSVPFACISF RCFRSVKELK  780
LVNLNIEEIP DGIFSCQNLE KLDLSGNDFV SLPNAIGDDL RNLKYLSLHN CRRIKSLPRL  840
SQVKTLILSE CVNLRSFMKI HPRETYCLLE LWLDNCKHVR SLSESLSVFT TLTYLDLSRH  900
DFVRLPQSIR EFSSLATLYL NYCKKLKSVE ELPQSLKYLY AHGCDSLEKV SLSPNHSIKH  960
IDLIHCPRLN QEEHKHLMDL FIHDGQSQEG SRRCACIPET GVSNDSGNET NQTSKKLSRT  1020
RKLFRYYSCD DSLLGVMHQM NKKDSTLPYL NTSISWGGVD ARPEHMQTTK QISFQDLDSP  1080
SSQSTCQSYT EVASSGDDNP SIQISFSTKS GSKETQQKGF ATHPNSSSLT GVHSIHFAPT  1140
QANFSFQYAD PHTGGLLAAT YLAQAPTCHP QMVGMVPGRV PLPVEITEAE PVFVNAKQYH  1200
AIMRRREQRA KLEAQNKLIK SRKPYLHESR HVHALKRPRG SGGRFLNTKQ LLQESEQAAA  1260
KKQEHDKSVQ QESKKTNMSR FEAHHMQQHN KDRGSTTSGS DITSVSDGAD IFRHTEFQFS  1320
GFSTTQTNRA MLVHGQSNDM HGGGDLHHFT VHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jrn_A3e-4041732168AT1G72930 protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.133090.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099533001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105585.10.0PREDICTED: putative disease resistance protein At4g11170
TrEMBLA0A078BWU30.0A0A078BWU3_BRANA; BnaA07g22940D protein
STRINGBra003867.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-170nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]